Help! My IOTA balance is zero! (steps to help you find your balance v2.5.7)


Help! My IOTA balance is zero! (steps to help you find your balance...
Author
Message
jhmblvd
j
Attached to Tangle (487 reputation)Attached to Tangle (487 reputation)Attached to Tangle (487 reputation)Attached to Tangle (487 reputation)Attached to Tangle (487 reputation)Attached to Tangle (487 reputation)Attached to Tangle (487 reputation)Attached to Tangle (487 reputation)Attached to Tangle (487 reputation)
Group: Forum Members
Posts: 12, Visits: 6
Alexa - 12 Jul 2018
Marcin - 12 Jul 2018
Alexa - 11 Jul 2018
Marcin - 11 Jul 2018
Hi again, I am trying to use recovery tool as instructed before.
Still getting an error, after having 'proof transaction confirmed' and pressing 'submit seed', I am getting:
'recovery_old_seed_has_balance'
But the balance is still 0.

Hey @Marcin,
maybe we should make sure first that you actually have to use the reclaim tool...
When have you last seen the funds in your wallet?
Do you know which address(es) your funds should be at? If you don’t know that address, you can find it by looking at the “withdrawal-history” of your exchange-account (e.g. Bitfinex or Binance or wherever you bought them).
Please post these addresses here, so we can have a look at them and check if you have to reclaim or not. Please DON'T post your seed!

https://thetangle.org/transaction/HYWSLENUSVZ9OKYSTFCSKVXHTETDIDTEAIDXQPZ9JMWINXTVOPTNGAUNQLMXSLSCJLOZHUZDMOQSZ9999

So I guess it's all there.
@Marcin
Yeah, if that's your only address, then this is clearly not a reclaim case. All you need to do is this:



It might be a little difficult right now to find a good node though.
But you could try this one:
Go to Tools -> Edit Node Configuration -> Select "Custom" and paste in this node: https://node03.iri.host:14267
Click SAVE and then log in with your "old" seed. Then go to the receive section and generate and attach addresses until the one with your balance pops up. The address you're looking for is this one: 
YDO9XLQNSHMBIRGDDGASQIATLZHOEYZJQERXOXCXF9KRTKWLVOM9DMSCJFXNLHIVGOJGOOYALMZLLOELYZZQJJ9IKA

Why is it so difficult to find a node? This seems so crazy. What is it that makes this so difficult? Other wallets seem to be able to handle simple things like showing balance?
CoinJohn
C
Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)
Group: Forum Members
Posts: 16, Visits: 7
EricHop - 25 Oct 2017
This is the latest incarnation of an article I wrote around the time of the October 2017 snapshot. I had been helping so many people find their balance again that I decided that my time would be better spent writing the process down for people to follow as a step by step guide that I could refer them to.

First of all, don’t panic, your iotas are most likely perfectly safe.

Second, no matter who or what, *never* give your seed to anyone. Especially not if they say they are an IOTA developer who will help you recover your balance. These people are usually scammers and will try to steal your iotas.

I will show the steps you can take to recover your balance. I will also try to explain to you why this happened. I recommend you take the time to read and understand the how and why. Understanding what you invested in is the best thing you can do to keep your investment safe.

Steps to find your balance

  1. First, make sure you upgrade to version 2.5.7 of the desktop wallet. You can safely skip older versions if you did not install those before. These older versions will no longer work correctly. You can find version 2.5.7 of the desktop wallet for Windows, Mac, and Linux here (don’t get confused by the title of the page, this is the latest wallet):
    https://github.com/iotaledger/wallet/releases
  2. Next, do not get tempted to use the reclaim tool. This tool will not help you regain your balance. It is only helpful in certain very specific cases. I will explain these cases at the end of this list. Just continue with step 3 first to find your balance again. If you did start the reclaim tool unnecessarily there’s no problem. You can still use your old seed and use the next steps to find your balance.
  3. After installing the new wallet you need to set up your wallet correctly. What you need to do is go to Tools->Edit Node Configuration.
  4. Make sure that a Host node is selected. If you see ‘Select Your Host’ in the Host field, use the drop down to select one. Usually any one will do. However, keep in mind that a host may be temporarily offline, so if after selecting one the wallet indicates No Connection you may want to select another Host. To find a node that is reliable use the list you find at:
    https://iota.dance/nodes
    The ones at the top are usually the best ones to select.
  5. Make sure that Min Weight Magnitude is set to 14. Higher values should be no problem but will just cause the Proof of Work to take much longer unnecessarily.
  6. Finally, you see a field that says Curl Implementation. The default is WebGL, which is a setting that allows the wallet to use your graphics card to do the Proof of Work, thereby possibly speeding up the process. However, some people will find that they get an Invalid Transaction Hash when they use this setting. The solutions for that are to either select CCURL instead, or to follow the instructions found in this link to make sure the wallet uses the correct graphics card:
    https://steemit.com/iota/@tector/iota-light-wallet-2-5-1-dealing-with-invalid-transaction-hash
  7. Note that it may be necessary to close and restart the wallet after changing any of those settings. I would do that just to be sure that the changes are activated.
  8. Now you can use your seed to log into the wallet, so you can start finding your balance again. Make absolutely sure that you are using the correct seed. Any typo in the seed will result in a different wallet, and trying to find your balance in there is not going to work, obviously. There is a helpful checksum field next to the field where you can enter your seed. The wallet will tell you if your seed is too short or too long. And if you have entered exactly 81 characters it will show you a 3 character checksum that should always be the same for every version of the wallet. It will allow you to very quickly see if you made a typo, since any typo will result in a different checksum. If you are not sure if you used the correct seed there are instructions further down to help you make sure.
  9. After logging into the wallet you click on the Receive section. It will show you a new receive address. Now click Attach To Tangle. It will show ‘Attaching to Tangle’ for a while. Just wait for that to complete. If it takes too long you could try a different, faster node as outlined in step 4. Once it says ‘Address Attached’ you may see your total balance get updated with the balance of that address. If not, then click ‘Address Attached’. It will now say ‘Generate New Address’. Click that again. That will cause the next address to be generated and it will show ‘Attaching to Tangle’ again. Keep repeating this loop until you have recovered your balance completely. You can click the History section to see how many and which addresses you have generated so far. Addresses can be in pending state but that does not matter for finding your balance. These attachment transactions do not need to confirm at all. They are zero value transactions, so they will not impact your balance anyway. You will need to generate all addresses you have used before for your entire balance to show up again. So if you have an idea of how many you used before that will be helpful. Most people should be able to find some or all of their balance within the first 20–30 addresses. But I know of people who needed to do 150+ re-attachments because they had been very active with their wallet. If your balance started to show up but never completely shows, and does not change any more after re-attaching don’t bother continuing. The funds are usually clustered at the end of the address list. Any funds still missing have probably been taken into custody (this only goes for wallets that have not been updated since before mid October 2017). See below for details on how to verify that.
If you did not manage to find your balance using these steps, I suggest you take the time to read through the explanations below. You need to be able to understand why it still does not show and what you can do about it. If you did find your balance? Congratulations! But I still suggest you educate yourself by reading the below explanations so you know what you are invested in. I know it’s a drag to have to go through such a long document, but we’re still in beta software stage with the wallet and IOTA as a whole. Understanding how it works is equal to protecting yourself from losing your funds.

How does an IOTA wallet work?

Contrary to what most people believe your IOTA wallet does *not* contain your iotas. Instead, your iotas are safely stored in one or more addresses in the Tangle. You can see your wallet as a browser that knows how to retrieve the balance of an address. To do that it contacts a so-called node, and asks it to find the balance of that address in the distributed ledger database that the Tangle actually is. To be able to retrieve your entire balance, the wallet will usually have to retrieve the balances of multiple addresses that belong to your wallet and add them all up. The end result is displayed as your current balance.

Now here is an important thing: the wallet does not know at first how many and which addresses exactly to retrieve to accumulate your balance. The only starting point it has is the 81-character seed you provided when you logged into the wallet. This seed is the key that enables the wallet to always re-generate the addresses used by your wallet deterministically. Deterministically means that given the same seed it will always be able to generate the exact same sequence of addresses one by one. To determine your total accumulated balance the wallet will ask the node for each address balance in succession until the node indicates that an address cannot be found because it is not present in a transaction in the Tangle. This indicates to the wallet that it has not generated/used that address before, so it can safely stop accumulating address balances. This fact is important to remember, because it will shortly explain why your balance is currently zero.

The wallet will generate new addresses as needed in two important ways. First, and most visible, when you want to receive iotas in your wallet you will need to generate a new receive address and attach that to the Tangle. Addresses are not supposed to be re-used because the signing process used to spend funds from an address uses one-time signatures. Because of the one-time nature of the signing process, the private key for that address gets partially exposed by every spend from the same address, opening it to a brute force attack. And since anyone that has the private key to an address can spend the funds in that address it’s not very wise to open yourself up to such an attack. That’s why the wallet tries to defend itself against such attacks by automatically moving the remaining funds after spending to a new address in the wallet. It will also give you a ‘private key reuse’ error whenever you try to spend to or from an address that already was spent from.

So the second way in which the wallet will generate new addresses is by moving the remainder of a spent address to a new address. When you instruct it to send a certain amount of iotas to another address, what it will do is go through the known addresses in your wallet one by one, starting from the first, by generating the addresses in sequence from the seed. The wallet accumulates the amount of iotas it finds along the way on addresses with a non-zero balance, until it has accumulated enough iotas to cover the amount you want to send. The contents of the non-zero addresses it has accumulated in this way will be sent as a single transfer to the receiving address and -if there is a remainder- the remainder will be sent as a second transfer to a newly generated address in your wallet. This will cause the latter address to be attached to the Tangle, so it lives there now, and the wallet will be able to see it as in use already whenever it scans for your balance as outlined above. All addresses used as the input for the transaction will end up having a zero balance, so they are not likely to be re-used any more, unless you make the mistake of not creating a new receive address but re-using a previous one.

It is important for the snapshot recovery process that you have an idea of how many addresses were in use before you ‘lost’ your balance (before the snapshot happened, see below). For most people that will be up to one or two dozen addresses. But for people who used the wallet regularly before the snapshot happened that can easily go up in the hundreds. I personally have helped someone retrieve his balance who had 150+ addresses in use in his wallet.

Why is my balance zero?

To understand what happened you need to know what happens when the IOTA foundation generates a new snapshot of the IOTA ledger database. This is done every now and then for maintenance reasons. The last snapshot was created on January 28th, 2018. One reason for taking a snapshot is that the Tangle is constantly expanding, and therefore taking up more and more memory. To help nodes in keeping the amount of memory they need for storing the database limited, the Tangle is pruned by removing the history of transactions. Remember that after every transaction you end up with no longer used addresses with a zero balance. The transactions that caused these only take up space and are no longer necessary for correct functioning of the nodes. There are even more ways that can cause zero balance transactions to occur, like when a wallet generates and attaches a new address to the Tangle. There are also transactions that are used as messages between systems and do not contain any balance.

So after a snapshot is taken the end result is a simple list of all addresses that contain a non-zero balance and their respective balances, plus a list of all addresses that have been spent from in the past, and no history of how those balances happened is preserved on the regular nodes. By the way, this history does get preserved on so called perma-nodes, like ioatsear.ch and thetangle.org, which will keep track of the entire history all the way back to the first transaction ever. But for most use cases this history is not necessary. It’s only the non-zero end balances that are important, since they are the only ones that can be spent.

Note that the snapshot process is such that any transactions that were not confirmed yet while the snapshot was being taken will be canceled and it will be as if the funds never left the wallet of the sender. So that means some transactions may have to be performed again once you have restored your wallet. A deposit from your wallet to Bitfinex that was canceled will have never left your wallet. A withdrawal from Bitfinex to your wallet that was canceled will have never left the Bitfinex wallet. Just send those transactions again when that happened. They should pose no problem. But make sure to confirm them quickly by reattaching/promoting them until they are confirmed.

Now, remember how the wallet will figure out its balance? It will ask a node to retrieve the balances of each address it generates in succession from the seed, starting with the first one, that has been used in a transaction, until it finds a non-used address, which indicates that the wallet did not generate that address before. However, since the snapshot has removed all historical transactions the first address it checks will not be found to be used by a transaction in the Tangle, and so the wallet stops scanning for balances immediately, because it thinks it has not generated that address yet, ultimately resulting in a zero accumulated balance.

So that’s the reason you see a zero balance. The wallet simply stopped scanning for addresses with balances too soon, because it does not know that the snapshot process has removed the transaction history. This means that the remedy for finding your balance is simple. Start re-generating and attaching your previously used receive addresses one by one. This will cause zero-balance transactions using that address to be connected to the Tangle. Which means the wallet now can see the address is in use in the Tangle and ask the node for the corresponding balance. In particular, you need to do this as many times as you had used addresses in the past, so that they can all be found in the Tangle again. To be sure, this can be a tedious process and it would have been nice if the wallet designers had included a command that allows you to tell it to generate the next X addresses until it finds one with a balance. But that is not the case at the moment, so there is no use in complaining right now. I am sure this feature will show up in a next incarnation of the wallet.

Why is the wallet still not able to find my balance?

The Sep 22nd and Oct 24th Snapshot processes have done two additional maintenance tasks that may result in you still not being able to successfully retrieve your correct balance.

First, since the implementation of the signing function has changed from CURL to KERL, in August there was a need to transition balances to the use of the new KERL implementation. A lot of people already did this transition as part of their upgrading their wallet from an older version to version 2.4.0. Since it turned out that there are people who managed to lose their seed and also many people who did not transition yet, the IOTA foundation has taken the precaution to remove those old-style CURL addresses from the Tangle and has taken custody of them. So if your previous wallet was from before version 2.4.0 you may fall into that category. You will need to use the reclaim tool as explained further down to reclaim those funds.

Second, because it was found that quite a number of people had spent multiple times from the same address, thereby exposing their funds to being stolen, the IOTA foundation decided to take similar custody of those addresses so they are no longer vulnerable. That means if you accidentally spent from the same address more than once in the past, and this address was still holding a balance, you will need to use the reclaim tool as explained further down to reclaim those funds.

In both cases one or more of your address balances may still be ‘missing’ even after the wallet has re-generated the missing address in the Tangle. The balance of such addresses was moved to the IOTA foundation custody address. You can check for those addresses if you think that may be what has happened to them here:
https://gist.githubusercontent.com/cyclux/2bb05d873c4ec6115cad1d100263d489/raw/612a49e46091586957448f6606ea981ab18022e7/snapshot_validation_20171023.txt
Allow for the page to load before searching through it, as it is a huge list.

You just copy an address you want to find out about to the clipboard, and then use control-F and paste to search on that page. Make sure you only use the first 81 characters of the address, as the 9 character checksum is not present in this list. I usually just paste the address and delete the last 9 characters.

If your address shows a category of KEY_REUSE or KEY_REUSE_OCT in this list then you have executed more than one spend from that address and the balance is now in custody of the IOTA foundation until you reclaim it.

If your address shows a category of CURL_UNUSED then your address was not transitioned to the new KERL implementation yet and the balance is also in custody of the IOTA foundation until you reclaim it.

If your address shows a category of NONE or AVAILABLE then your address was okay and should still be present in the Tangle unless you moved the funds at a later date.
For more details, see this announcement from the foundation:
https://forum.iota.org/t/snapshot-public-validation-22-09-2017/4256

How do I make sure I am using the correct seed?

If you don’t remember the 3-character checksum or in any other way are unsure if you are using the correct seed, here are ways to find out:

  • If you know roughly how many addresses you used to have in your wallet, just go ahead and re-generate at least that amount of new receive addresses (detailed steps below). Along the way, usually towards the end, you should see your balance increasing. If your balance becomes non-zero that is a clue that you are definitely in your own wallet with the correct seed. If you cannot seem to get the entire balance you may either need to generate even more addresses, or some of your funds were taken into custody by the IOTA foundation for the reasons described above. In that case you will have to check the addresses which you think should contain a non-zero balance against the snapshot list. And if you find them there, you will have to reclaim them using the reclaim tool.
  • Making double sure that you are using the correct wallet can be easily done by using the iotasear.ch or thetangle.org Tangle browsers to check the history of an address. This means you can copy the first address and see if in the past funds were there. Assuming the first address was the first one to receive funds, of course. If it did contain funds in the past the amount is probably recognizable as your first IOTA withdrawal ever. Anyway, when any funds are there in the iotasear.ch or thetangle.org history you can be sure you have used this seed before.

How do I use the reclaim tool?

If you are absolutely sure that the IOTA foundation took custody of some of your funds after checking the above, you will need to use the reclaim tool to reclaim your funds. Note that the reclaim process is a two-step process currently.

NOTE: to make sure that you don’t make any typos when entering your old and new seeds with this tool i highly suggest you copy/paste them from a proven working copy. It would be silly to finally reclaim your funds to a seed that contains a typo and therefore the reclaimed funds would become irretrievable.

UPDATE: The reclaim tool in phase 2 will ask once again for the new seed, so unless you make the same typo twice this seems not really to be a problem.
In case multiple reclaims were put in, the one confirmed in the lowest milestone will be the one processed.

For more details on how to use the reclaim tool see this link for phase 1:
https://blog.iota.org/gui-v2-5-2-latest-release-with-iota-reclaim-tool-32d364d6241a
And this link for phase 2:
https://blog.iota.org/gui-wallet-phase-two-of-the-reclaim-process-f5913109cf46

I hope this was helpful to you
Enjoy IOTA, let’s make it a success!

CoinJohn
C
Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)
Group: Forum Members
Posts: 16, Visits: 7
Hi Eric,'I read your instructions abut how to find my IOTA. You  said you copy an address to the clipboard and then use Ctl F paste to find that address in the lists of address taken care of by the foundation. I do have a Macbook. when I mark an address and copy it and then go onto the web age with all those secured addresses I cannot find a way how to past it there to see if mine address is amongst them? There is now box to past the address into or anything that I could find to past the address to.
May I Kindly ask you for some help please how I can find out if my addresses are taken into secure storage?  
With best regards. John

CoinJohn
C
Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)
Group: Forum Members
Posts: 16, Visits: 7
Alexa - 18 Jul 2018
CoinJohn - 18 Jul 2018
HI everybody, after reading all those posts I went back to Bitfinex and found the 4 addresses I sent my IOTA to last December. Turns to that 3 were the same address. Am I right then that the foundation would have taken the IOTA in?
If not, how can I specifically re-attach those address to recover my IOTA?  I downloaded the latest version of the wallet, 2.5.7.
With best regards. John
@CoinJohn
Hey John!
The Foundation never took any funds after October 23rd 2017. Not even when people reused addresses in a dangerous way. 

But it doesn't matter how often you send to the same address. It's perfectly secure as long as you don't spent from the same address more than once. After you've sent funds from an address, never receive to it again.
Best practice is to just generate a new address each time you want to receive. If you do this, you don't have to worry about address reuse.
Here's a cool Piggy Bank example that explains it:


If you can't see your funds in the wallet right now, it will probably be because of snapshots.
The wallet kind of "forgets" about your addresses after a snapshot and you have to help it remember them again.
To do this, log into the wallet with your Seed, go to the Receive Tab and click Generate New Address / Attach to Tangle. Repeat....
You'll have to generate all the addresses that you've used before the snapshot, only you can know how many you had. 

Addresses will always be generated in the same order. No. 1 will always pop up first, No. 2 will always come up second....
If your address that received funds from Bitfinex was No. 17, it will be No. 17 again now.
Just try it and please let us know if it works and if you have questions. Smile

CoinJohn
C
Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)Attaching to Tangle (42 reputation)
Group: Forum Members
Posts: 16, Visits: 7
Hi Alexa, read your reply only now, thank you. I will do the re-attaching business tonight. Just for y understanding please, when I start re-attching as you recommended, the wallet will automatically generate the same addresses I had before to find the funds? With kindest regards again.  John
Alexa
Alexa
True IOTAn (9.6K reputation)
Group: Moderators
Posts: 732, Visits: 1.4K
jhmblvd - 22 Jul 2018
Alexa - 12 Jul 2018
Marcin - 12 Jul 2018
Alexa - 11 Jul 2018
Marcin - 11 Jul 2018
Hi again, I am trying to use recovery tool as instructed before.
Still getting an error, after having 'proof transaction confirmed' and pressing 'submit seed', I am getting:
'recovery_old_seed_has_balance'
But the balance is still 0.

Hey @Marcin,
maybe we should make sure first that you actually have to use the reclaim tool...
When have you last seen the funds in your wallet?
Do you know which address(es) your funds should be at? If you don’t know that address, you can find it by looking at the “withdrawal-history” of your exchange-account (e.g. Bitfinex or Binance or wherever you bought them).
Please post these addresses here, so we can have a look at them and check if you have to reclaim or not. Please DON'T post your seed!

https://thetangle.org/transaction/HYWSLENUSVZ9OKYSTFCSKVXHTETDIDTEAIDXQPZ9JMWINXTVOPTNGAUNQLMXSLSCJLOZHUZDMOQSZ9999

So I guess it's all there.
@Marcin
Yeah, if that's your only address, then this is clearly not a reclaim case. All you need to do is this:



It might be a little difficult right now to find a good node though.
But you could try this one:
Go to Tools -> Edit Node Configuration -> Select "Custom" and paste in this node: https://node03.iri.host:14267
Click SAVE and then log in with your "old" seed. Then go to the receive section and generate and attach addresses until the one with your balance pops up. The address you're looking for is this one: 
YDO9XLQNSHMBIRGDDGASQIATLZHOEYZJQERXOXCXF9KRTKWLVOM9DMSCJFXNLHIVGOJGOOYALMZLLOELYZZQJJ9IKA

Why is it so difficult to find a node? This seems so crazy. What is it that makes this so difficult? Other wallets seem to be able to handle simple things like showing balance?
When you say 'other wallets', do you mean other cryptocurrencies' wallets?
Well, first of all, unlike other cryptos, IOTA doesn't use a blockchain, so therest no copy/paste solutions available. The Tangle is still in development and some things need to be figured out yet....

The second thing is that those current issues are not about the wallet, but the Tangle network itself. Here is some information on why the nodes are having problems and that it's going to be fixed in the next IRI version:
https://blog.iota.org/coming-soon-iri-1-5-2-52114ca67a70




I wouldn't be able to help anyone without thetangle.org-explorer. If you feel like you want to support its developer Mathieu Viossat in maintaining his service, please consider a donation to the address shown here: https://thetangle.org/about. Thank you!
Alexa
Alexa
True IOTAn (9.6K reputation)
Group: Moderators
Posts: 732, Visits: 1.4K
CoinJohn - 22 Jul 2018
Hi Alexa, read your reply only now, thank you. I will do the re-attaching business tonight. Just for y understanding please, when I start re-attching as you recommended, the wallet will automatically generate the same addresses I had before to find the funds? With kindest regards again.  John

Hey John,
exactly this. You will first generate your first old address and then all others one by one in the same order again.

To answer your question to Eric: when you press the Ctrl key on your keyboard, hold it and press F. This will open up a search field for you to type or paste in any stuff that you want to search for. Works on other documents and websites, too. Wink

I wouldn't be able to help anyone without thetangle.org-explorer. If you feel like you want to support its developer Mathieu Viossat in maintaining his service, please consider a donation to the address shown here: https://thetangle.org/about. Thank you!
mirkimc
m
Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)
Group: Forum Members
Posts: 3, Visits: 3
Hi,

i have a huge problem. I had a wallet with over 500GigaIOTA on it and after generating ~60 addresses it's still 0 balance. I don't think that i ever used as many addresses.

I need serious help. What information do you need from me? Could the recent problems with the tangle have something to do with it? How can i find out if the GIOTA were stolen from the wallet, when it occured before the last snapshot?

This is one of the addresses: QCGFIIQXKSYHVGAJJIXDNFSKDKDLDWPNIFFOHBETEMLUMWVAMZJIUUHSGLZBMBQ9R9DOSTRDPRFKBLRIA
Alexa
Alexa
True IOTAn (9.6K reputation)
Group: Moderators
Posts: 732, Visits: 1.4K
mirkimc - 25 Jul 2018
Hi,

i have a huge problem. I had a wallet with over 500GigaIOTA on it and after generating ~60 addresses it's still 0 balance. I don't think that i ever used as many addresses.

I need serious help. What information do you need from me? Could the recent problems with the tangle have something to do with it? How can i find out if the GIOTA were stolen from the wallet, when it occured before the last snapshot?

This is one of the addresses: QCGFIIQXKSYHVGAJJIXDNFSKDKDLDWPNIFFOHBETEMLUMWVAMZJIUUHSGLZBMBQ9R9DOSTRDPRFKBLRIA

Hi @mirkimc,
welcome to Hello IOTA!

The address you posted never had any funds on it and only got attached to the Tangle three weeks ago. I think you can stop attaching more addresses. 
When have you last seen the funds in your wallet?
Do you know which address(es) your funds should be at?
If you don’t know, you can find out by looking at the “withdrawal-history” of your exchange-account (e.g. Bitfinex or Binance or wherever you bought them).
If you know which address(es) should hold your funds, please post them here or send them to me via PM if that makes you feel more comfortable.
We can then have a look at them on a tangle explorer and see what happened.
Please DON'T post your seed!

I wouldn't be able to help anyone without thetangle.org-explorer. If you feel like you want to support its developer Mathieu Viossat in maintaining his service, please consider a donation to the address shown here: https://thetangle.org/about. Thank you!
gul
g
Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)
Group: Forum Members
Posts: 3, Visits: 0
Hi there,

I usually don't have any problems with iota light wallet, but today I need your help if possible. I logged in after about 3 months of absence and my balance is 0. I checked that I still have the latest version of light wallet, 2.5.7 it is. The earlier snapshot isn't an issue, I've been through that long before my last login.

In history I see 0 transactions and 2 adresses.
first adress is
RXUGS9QGBRHVSUWHXQPYHRSFKIKNODDOSRKDHVSBSALIUAJJFOPNKUGJ9FUDSVTVUNRDLVOHXCNKIKMADVAIONZCOD
second adress is
UJQPMEYTKMEOLEZSH9ZTSCFEFXKOWLCWQKQXLAEMLUL9GEIRNQUJNRJ9RSKXMHDOLFIESGOCXYJKDZFTYCIKALYUEC

iotaser.ch always comes up with an error 404 - for both adresses. what do I miss / do wrong?

Help would be highly appreciated. :-)
mirkimc
m
Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)
Group: Forum Members
Posts: 3, Visits: 3
Alexa - 26 Jul 2018
mirkimc - 25 Jul 2018
Hi,

i have a huge problem. I had a wallet with over 500GigaIOTA on it and after generating ~60 addresses it's still 0 balance. I don't think that i ever used as many addresses.

I need serious help. What information do you need from me? Could the recent problems with the tangle have something to do with it? How can i find out if the GIOTA were stolen from the wallet, when it occured before the last snapshot?

This is one of the addresses: QCGFIIQXKSYHVGAJJIXDNFSKDKDLDWPNIFFOHBETEMLUMWVAMZJIUUHSGLZBMBQ9R9DOSTRDPRFKBLRIA

Hi @mirkimc,
welcome to Hello IOTA!

The address you posted never had any funds on it and only got attached to the Tangle three weeks ago. I think you can stop attaching more addresses. 
When have you last seen the funds in your wallet?
Do you know which address(es) your funds should be at?
If you don’t know, you can find out by looking at the “withdrawal-history” of your exchange-account (e.g. Bitfinex or Binance or wherever you bought them).
If you know which address(es) should hold your funds, please post them here or send them to me via PM if that makes you feel more comfortable.
We can then have a look at them on a tangle explorer and see what happened.
Please DON'T post your seed!

Thank you for responding, Alexa.

I have seen the funds 2-3 months ago on this wallet. What about those: XNLULLMWMAKEXGXFUFWSSQITDOFHXLZSCUEGD9MVBSDZVCGLETLFHQUAMXKLQLSLDVLDEGHVNNVNVMNTYDQVEPPQDW
BBWHAYIJSS9W9QMVEVL9CTRNKEWPXSXRECLGMCCWG9ABAQGVPD9AVVUNOUYOKPJLVKGTYPHAARQMHLENWKWMSFENHC
SWVVHDZNBQALJXTKFJPCEP9ZQNBGGDKIQ9EGOOCGIQAHKUQENCYVWYPKPUHG9XQPTTKSFPKWLMNDIGNRBOOQYBCOOB

They should all belong to the wallet where the funds do not show up and the first one starting with XNL shows at least that there still must be funds on it.


I tried to access my wallet from a country on the other side of the world, one month ago. The address attachments took 5 minutes each but i tried nonetheless. Could i have produced some sort of error? 

Edited Last Year by mirkimc
Winston
Winston
Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)
Group: Administrators
Posts: 3.6K, Visits: 6.8K
gul - 26 Jul 2018
Hi there,

I usually don't have any problems with iota light wallet, but today I need your help if possible. I logged in after about 3 months of absence and my balance is 0. I checked that I still have the latest version of light wallet, 2.5.7 it is. The earlier snapshot isn't an issue, I've been through that long before my last login.

In history I see 0 transactions and 2 adresses.
first adress is
RXUGS9QGBRHVSUWHXQPYHRSFKIKNODDOSRKDHVSBSALIUAJJFOPNKUGJ9FUDSVTVUNRDLVOHXCNKIKMADVAIONZCOD
second adress is
UJQPMEYTKMEOLEZSH9ZTSCFEFXKOWLCWQKQXLAEMLUL9GEIRNQUJNRJ9RSKXMHDOLFIESGOCXYJKDZFTYCIKALYUEC

iotaser.ch always comes up with an error 404 - for both adresses. what do I miss / do wrong?

Help would be highly appreciated. :-)

@gul 
Thanks for the post - let's take a look:

The first address had an outgoing transaction of 1.41 Gi on January 24, leaving its current balance at 0.
https://thetangle.org/address/RXUGS9QGBRHVSUWHXQPYHRSFKIKNODDOSRKDHVSBSALIUAJJFOPNKUGJ9FUDSVTVUNRDLVOHXCNKIKMAD

The second address had an outgoing transaction of 2 Gi on December 15, leaving its current balance at 0.
https://thetangle.org/address/UJQPMEYTKMEOLEZSH9ZTSCFEFXKOWLCWQKQXLAEMLUL9GEIRNQUJNRJ9RSKXMHDOLFIESGOCXYJKDZFTY

If you were the one who made each of those outgoing transactions, then they the remaining balances were sent to addresses indexed further down in your wallet. So I'd recommend generating ~30 more addresses, and then checking back in here with the results.
 
 
Winston
Winston
Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)Forum Admin (33K reputation)
Group: Administrators
Posts: 3.6K, Visits: 6.8K
mirkimc - 26 Jul 2018
Alexa - 26 Jul 2018
mirkimc - 25 Jul 2018
Hi,

i have a huge problem. I had a wallet with over 500GigaIOTA on it and after generating ~60 addresses it's still 0 balance. I don't think that i ever used as many addresses.

I need serious help. What information do you need from me? Could the recent problems with the tangle have something to do with it? How can i find out if the GIOTA were stolen from the wallet, when it occured before the last snapshot?

This is one of the addresses: QCGFIIQXKSYHVGAJJIXDNFSKDKDLDWPNIFFOHBETEMLUMWVAMZJIUUHSGLZBMBQ9R9DOSTRDPRFKBLRIA

Hi @mirkimc,
welcome to Hello IOTA!

The address you posted never had any funds on it and only got attached to the Tangle three weeks ago. I think you can stop attaching more addresses. 
When have you last seen the funds in your wallet?
Do you know which address(es) your funds should be at?
If you don’t know, you can find out by looking at the “withdrawal-history” of your exchange-account (e.g. Bitfinex or Binance or wherever you bought them).
If you know which address(es) should hold your funds, please post them here or send them to me via PM if that makes you feel more comfortable.
We can then have a look at them on a tangle explorer and see what happened.
Please DON'T post your seed!

Thank you for responding, Alexa.

I have seen the funds 2-3 months ago on this wallet. What about those: XNLULLMWMAKEXGXFUFWSSQITDOFHXLZSCUEGD9MVBSDZVCGLETLFHQUAMXKLQLSLDVLDEGHVNNVNVMNTYDQVEPPQDW
BBWHAYIJSS9W9QMVEVL9CTRNKEWPXSXRECLGMCCWG9ABAQGVPD9AVVUNOUYOKPJLVKGTYPHAARQMHLENWKWMSFENHC
SWVVHDZNBQALJXTKFJPCEP9ZQNBGGDKIQ9EGOOCGIQAHKUQENCYVWYPKPUHG9XQPTTKSFPKWLMNDIGNRBOOQYBCOOB

They should all belong to the wallet where the funds do not show up and the first one starting with XNL shows at least that there still must be funds on it.


I tried to access my wallet from a country on the other side of the world, one month ago. The address attachments took 5 minutes each but i tried nonetheless. Could i have produced some sort of error? 

@mirkimc
I see that Alexa is already assisting here, so I'll leave some details here to make both of your lives easier:

Current balance: 10 Gi
https://thetangle.org/address/XNLULLMWMAKEXGXFUFWSSQITDOFHXLZSCUEGD9MVBSDZVCGLETLFHQUAMXKLQLSLDVLDEGHVNNVNVMNTY

Current balance: 0 Gi (outgoing transaction of 100 Gi on January 9 <-- did you make this transaction?)
BBWHAYIJSS9W9QMVEVL9CTRNKEWPXSXRECLGMCCWG9ABAQGVPD9AVVUNOUYOKPJLVKGTYPHAARQMHLENWKWMSFENHC

Current balance: 0 Gi (outgoing transaction of 1 Ti on December 6)
https://thetangle.org/address/SWVVHDZNBQALJXTKFJPCEP9ZQNBGGDKIQ9EGOOCGIQAHKUQENCYVWYPKPUHG9XQPTTKSFPKWLMNDIGNRB


I'll have time to read your posts and look into this further over the weekend if there is still confusion after Alexa imparts her wisdom.
 

mirkimc
m
Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)Attaching to Tangle (8 reputation)
Group: Forum Members
Posts: 3, Visits: 3
Winston - 26 Jul 2018
mirkimc - 26 Jul 2018
Alexa - 26 Jul 2018
mirkimc - 25 Jul 2018
Hi,

i have a huge problem. I had a wallet with over 500GigaIOTA on it and after generating ~60 addresses it's still 0 balance. I don't think that i ever used as many addresses.

I need serious help. What information do you need from me? Could the recent problems with the tangle have something to do with it? How can i find out if the GIOTA were stolen from the wallet, when it occured before the last snapshot?

This is one of the addresses: QCGFIIQXKSYHVGAJJIXDNFSKDKDLDWPNIFFOHBETEMLUMWVAMZJIUUHSGLZBMBQ9R9DOSTRDPRFKBLRIA

Hi @mirkimc,
welcome to Hello IOTA!

The address you posted never had any funds on it and only got attached to the Tangle three weeks ago. I think you can stop attaching more addresses. 
When have you last seen the funds in your wallet?
Do you know which address(es) your funds should be at?
If you don’t know, you can find out by looking at the “withdrawal-history” of your exchange-account (e.g. Bitfinex or Binance or wherever you bought them).
If you know which address(es) should hold your funds, please post them here or send them to me via PM if that makes you feel more comfortable.
We can then have a look at them on a tangle explorer and see what happened.
Please DON'T post your seed!

Thank you for responding, Alexa.

I have seen the funds 2-3 months ago on this wallet. What about those: XNLULLMWMAKEXGXFUFWSSQITDOFHXLZSCUEGD9MVBSDZVCGLETLFHQUAMXKLQLSLDVLDEGHVNNVNVMNTYDQVEPPQDW
BBWHAYIJSS9W9QMVEVL9CTRNKEWPXSXRECLGMCCWG9ABAQGVPD9AVVUNOUYOKPJLVKGTYPHAARQMHLENWKWMSFENHC
SWVVHDZNBQALJXTKFJPCEP9ZQNBGGDKIQ9EGOOCGIQAHKUQENCYVWYPKPUHG9XQPTTKSFPKWLMNDIGNRBOOQYBCOOB

They should all belong to the wallet where the funds do not show up and the first one starting with XNL shows at least that there still must be funds on it.


I tried to access my wallet from a country on the other side of the world, one month ago. The address attachments took 5 minutes each but i tried nonetheless. Could i have produced some sort of error? 

@mirkimc
I see that Alexa is already assisting here, so I'll leave some details here to make both of your lives easier:

Current balance: 10 Gi
https://thetangle.org/address/XNLULLMWMAKEXGXFUFWSSQITDOFHXLZSCUEGD9MVBSDZVCGLETLFHQUAMXKLQLSLDVLDEGHVNNVNVMNTY

Current balance: 0 Gi (outgoing transaction of 100 Gi on January 9 <-- did you make this transaction?)
BBWHAYIJSS9W9QMVEVL9CTRNKEWPXSXRECLGMCCWG9ABAQGVPD9AVVUNOUYOKPJLVKGTYPHAARQMHLENWKWMSFENHC

Current balance: 0 Gi (outgoing transaction of 1 Ti on December 6)
https://thetangle.org/address/SWVVHDZNBQALJXTKFJPCEP9ZQNBGGDKIQ9EGOOCGIQAHKUQENCYVWYPKPUHG9XQPTTKSFPKWLMNDIGNRB


I'll have time to read your posts and look into this further over the weekend if there is still confusion after Alexa imparts her wisdom.
 

Thanks to everyone. If figured out what went wrong - a wrong seed written down ._.  I'm sorry! THANK YOU!
Johnw
J
Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)
Group: Forum Members
Posts: 4, Visits: 12
Hello

My IOTA balance disappeared, after purchasing on Binance and sending to my light wallet successfully.

I reached out to contact@iota.org and they told me my funds can be seen here:https://thetangle.org/bundle/JISLFNTVBUCJLVFQHAQDWHQFDBCPPJMEAIYBGDAKUZZVLTGFNSDICKJYLLPOJZUUHHKEACGAEPCZIBGIY

The amount is correct, but I don't recognise those addresses

Can someone help me understand what happened?

I have the withdraw history on binance but apart from that and the information from Andrew@iota i'm stuck!

Alexa
Alexa
True IOTAn (9.6K reputation)
Group: Moderators
Posts: 732, Visits: 1.4K
Johnw - 26 Jul 2018
Hello

My IOTA balance disappeared, after purchasing on Binance and sending to my light wallet successfully.

I reached out to contact@iota.org and they told me my funds can be seen here:https://thetangle.org/bundle/JISLFNTVBUCJLVFQHAQDWHQFDBCPPJMEAIYBGDAKUZZVLTGFNSDICKJYLLPOJZUUHHKEACGAEPCZIBGIY

The amount is correct, but I don't recognise those addresses

Can someone help me understand what happened?

I have the withdraw history on binance but apart from that and the information from Andrew@iota i'm stuck!

Hi John, 
welcome to Hello IOTA!
If you have your withdrawal history, please post the address(es) where you sent your funds to so we can look them up on a tangle explorer. Please don't post your seed. 

I wouldn't be able to help anyone without thetangle.org-explorer. If you feel like you want to support its developer Mathieu Viossat in maintaining his service, please consider a donation to the address shown here: https://thetangle.org/about. Thank you!
Alexa
Alexa
True IOTAn (9.6K reputation)
Group: Moderators
Posts: 732, Visits: 1.4K
mirkimc - 26 Jul 2018
Winston - 26 Jul 2018
mirkimc - 26 Jul 2018
Alexa - 26 Jul 2018
mirkimc - 25 Jul 2018
Hi,

i have a huge problem. I had a wallet with over 500GigaIOTA on it and after generating ~60 addresses it's still 0 balance. I don't think that i ever used as many addresses.

I need serious help. What information do you need from me? Could the recent problems with the tangle have something to do with it? How can i find out if the GIOTA were stolen from the wallet, when it occured before the last snapshot?

This is one of the addresses: QCGFIIQXKSYHVGAJJIXDNFSKDKDLDWPNIFFOHBETEMLUMWVAMZJIUUHSGLZBMBQ9R9DOSTRDPRFKBLRIA

Hi @mirkimc,
welcome to Hello IOTA!

The address you posted never had any funds on it and only got attached to the Tangle three weeks ago. I think you can stop attaching more addresses. 
When have you last seen the funds in your wallet?
Do you know which address(es) your funds should be at?
If you don’t know, you can find out by looking at the “withdrawal-history” of your exchange-account (e.g. Bitfinex or Binance or wherever you bought them).
If you know which address(es) should hold your funds, please post them here or send them to me via PM if that makes you feel more comfortable.
We can then have a look at them on a tangle explorer and see what happened.
Please DON'T post your seed!

Thank you for responding, Alexa.

I have seen the funds 2-3 months ago on this wallet. What about those: XNLULLMWMAKEXGXFUFWSSQITDOFHXLZSCUEGD9MVBSDZVCGLETLFHQUAMXKLQLSLDVLDEGHVNNVNVMNTYDQVEPPQDW
BBWHAYIJSS9W9QMVEVL9CTRNKEWPXSXRECLGMCCWG9ABAQGVPD9AVVUNOUYOKPJLVKGTYPHAARQMHLENWKWMSFENHC
SWVVHDZNBQALJXTKFJPCEP9ZQNBGGDKIQ9EGOOCGIQAHKUQENCYVWYPKPUHG9XQPTTKSFPKWLMNDIGNRBOOQYBCOOB

They should all belong to the wallet where the funds do not show up and the first one starting with XNL shows at least that there still must be funds on it.


I tried to access my wallet from a country on the other side of the world, one month ago. The address attachments took 5 minutes each but i tried nonetheless. Could i have produced some sort of error? 

@mirkimc
I see that Alexa is already assisting here, so I'll leave some details here to make both of your lives easier:

Current balance: 10 Gi
https://thetangle.org/address/XNLULLMWMAKEXGXFUFWSSQITDOFHXLZSCUEGD9MVBSDZVCGLETLFHQUAMXKLQLSLDVLDEGHVNNVNVMNTY

Current balance: 0 Gi (outgoing transaction of 100 Gi on January 9 <-- did you make this transaction?)
BBWHAYIJSS9W9QMVEVL9CTRNKEWPXSXRECLGMCCWG9ABAQGVPD9AVVUNOUYOKPJLVKGTYPHAARQMHLENWKWMSFENHC

Current balance: 0 Gi (outgoing transaction of 1 Ti on December 6)
https://thetangle.org/address/SWVVHDZNBQALJXTKFJPCEP9ZQNBGGDKIQ9EGOOCGIQAHKUQENCYVWYPKPUHG9XQPTTKSFPKWLMNDIGNRB


I'll have time to read your posts and look into this further over the weekend if there is still confusion after Alexa imparts her wisdom.
 

Thanks to everyone. If figured out what went wrong - a wrong seed written down ._.  I'm sorry! THANK YOU!

Awesome, thanks for letting us know!
No need to be sorry, it's great to hear that you figured it out!

I wouldn't be able to help anyone without thetangle.org-explorer. If you feel like you want to support its developer Mathieu Viossat in maintaining his service, please consider a donation to the address shown here: https://thetangle.org/about. Thank you!
Johnw
J
Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)
Group: Forum Members
Posts: 4, Visits: 12
Alexa - 26 Jul 2018
Johnw - 26 Jul 2018
Hello

My IOTA balance disappeared, after purchasing on Binance and sending to my light wallet successfully.

I reached out to contact@iota.org and they told me my funds can be seen here:https://thetangle.org/bundle/JISLFNTVBUCJLVFQHAQDWHQFDBCPPJMEAIYBGDAKUZZVLTGFNSDICKJYLLPOJZUUHHKEACGAEPCZIBGIY

The amount is correct, but I don't recognise those addresses

Can someone help me understand what happened?

I have the withdraw history on binance but apart from that and the information from Andrew@iota i'm stuck!

Hi John, 
welcome to Hello IOTA!
If you have your withdrawal history, please post the address(es) where you sent your funds to so we can look them up on a tangle explorer. Please don't post your seed. 

Hi Alexa!

Sure that would be great -  do you need the address or the txid or both from binance?



Alexa
Alexa
True IOTAn (9.6K reputation)
Group: Moderators
Posts: 732, Visits: 1.4K
Johnw - 26 Jul 2018
Alexa - 26 Jul 2018
Johnw - 26 Jul 2018
Hello

My IOTA balance disappeared, after purchasing on Binance and sending to my light wallet successfully.

I reached out to contact@iota.org and they told me my funds can be seen here:https://thetangle.org/bundle/JISLFNTVBUCJLVFQHAQDWHQFDBCPPJMEAIYBGDAKUZZVLTGFNSDICKJYLLPOJZUUHHKEACGAEPCZIBGIY

The amount is correct, but I don't recognise those addresses

Can someone help me understand what happened?

I have the withdraw history on binance but apart from that and the information from Andrew@iota i'm stuck!

Hi John, 
welcome to Hello IOTA!
If you have your withdrawal history, please post the address(es) where you sent your funds to so we can look them up on a tangle explorer. Please don't post your seed. 

Hi Alexa!

Sure that would be great -  do you need the address or the txid or both from binance?



The addresses would be best. I'll probably look them up tomorrow though, I need to catch some sleep now. But maybe someone else could chime in in the meantime...

I wouldn't be able to help anyone without thetangle.org-explorer. If you feel like you want to support its developer Mathieu Viossat in maintaining his service, please consider a donation to the address shown here: https://thetangle.org/about. Thank you!
Johnw
J
Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)Attaching to Tangle (25 reputation)
Group: Forum Members
Posts: 4, Visits: 12
No problem thanks Alexa address(es) below:

UIGCMVGFZWELGKONSAVAREKKJPTPCJVDMFAAHOOWZMCQBFGGHKVISXTNNDZLMFRGSUKXQWOPBPHUTDSZYWNJCBTKCB

MNKIDDUMRCWILOULCTNQUZSNAXBYAXEYEBXLXZDCQDHGVFKHFBXBSGANCCVRSHOJGELETCVRVTKPFUCYYYMZRDAZJD

FVNHZLOLO9AKMLVWAOUOSLMUBJIYTEMEDDZCCEPHOHQYXEWEXNGFKEDLAUOHPWPNUKBGXCUHTCEQ9RQWWSPUZCXYKZ


GO

Merge Selected

Merge into selected topic...



Merge into merge target...



Merge into a specific topic ID...




Reading This Topic

Login

Explore
Messages
Mentions
Search